PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000204582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 369aa    MW: 41847.5 Da    PI: 4.5892
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000204582genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.4e-5661331128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s
  MDP0000204582   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVNS 100
                    79****************************.99**************96435566888************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  MDP0000204582 101 -QRRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                    .8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-623175IPR003441NAC domain
PROSITE profilePS5100559.1176175IPR003441NAC domain
PfamPF023656.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVNS QRRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDSVCGN GSSSIKKEII FGYLPPNPMN QVIRDSYALC RVFKKTIQMP  180
KSNKEYTPIG INNADNDSIW VSNEQLLGED TSGINEGASR GIETDQDEND SNHDYPKFLS  240
DTSSSDLTQG TPTETGIADD LQAPFASDEA NSSADLYSFG VHCSSDLLQE TYIPPNASSL  300
NTYQFPYPPL ELEDFPQINL AAETNTAKPE IIDKYMSYDK FKDYMNGSFE EIFSLCSSQD  360
NSVALSMQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-57117512165NAC domain-containing protein 19
4dul_A2e-57117512165NAC domain-containing protein 19
1ut7_B2e-57117512165NO APICAL MERISTEM PROTEIN
1ut7_A2e-57117512165NO APICAL MERISTEM PROTEIN
1ut4_B2e-57117512165NO APICAL MERISTEM PROTEIN
1ut4_A2e-57117512165NO APICAL MERISTEM PROTEIN
3swp_D2e-57117515168NAC domain-containing protein 19
3swp_C2e-57117515168NAC domain-containing protein 19
3swp_B2e-57117515168NAC domain-containing protein 19
3swp_A2e-57117515168NAC domain-containing protein 19
3swm_D2e-57117515168NAC domain-containing protein 19
3swm_C2e-57117515168NAC domain-containing protein 19
3swm_B2e-57117515168NAC domain-containing protein 19
3swm_A2e-57117515168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383208.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18180.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-103NAC domain containing protein 20